Hidden Veggie Maple Oat Bake | DishGen Recipe
remove ads with Premium »

Hidden Veggie Maple Oat Bake

Hidden Veggie Maple Oat Bake image
AbbyandDuke
creator
7/25/2026
date
6
servings
1
bookmarks
New · AI Nutrition FactsSign up to generate calories, macros, and more for this recipe »
Original Prompt
"oatmeal bake with hidden veggies"
Ratings (N/A)
create a free account to rate this recipe
AI Recipe Notice
Note: This recipe is AI-generated and DishGen has not verified it for accuracy or safety. Use your best judgement when making AI-generated dishes. If you notice an issue, please report this recipe.
Print

A cozy, healthy oatmeal bake packed with hidden carrots and zucchini for natural sweetness and moisture. Made with gluten-free oats, eggs, Greek yogurt, warm cinnamon, and a touch of maple syrup, this wholesome breakfast bake is easy to prep, protein-rich, and low in gluten. Great for meal prep, picky eaters, or a nourishing grab-and-go morning.

breakfastglutenfreehealthymealprepvegetarian

DishGen

Hidden Veggie Maple Oat Bake

Servings: 6

A cozy, healthy oatmeal bake packed with hidden carrots and zucchini for natural sweetness and moisture. Made with gluten-free oats, eggs, Greek yogurt, warm cinnamon, and a touch of maple syrup, this wholesome breakfast bake is easy to prep, protein-rich, and low in gluten. Great for meal prep, picky eaters, or a nourishing grab-and-go morning.

AI-Generated Recipe from DishGen - https://dishgen.com/recipes/ 6a64fb5e842ac20957f37f83
remove ads with Premium »

Related Recipes

Similar ideas from the DishGen community.

Comments

No comments yet.

Links on this page may be affiliate links. If you use them to make a purchase, we may earn a small commission at no extra cost to you. Thank you for your support!